Adenine glycosylase active on G-A mispairs. MutY also corrects error-prone DNA synthesis past GO lesions which are due to the oxidatively damaged form of guanine: 7,8-dihydro-8-oxoguanine (8-oxo-dGTP).

Belongs to the Nth/MutY family.

378 amino acids

MLAKSSINAPFAKSVLAWYDKFGRKHLPWQQNKTLYGVWLSEVMLQQTQVATVIPYFERFIKTFPNITALANASQDEVLHLWTGLGYYARARNLHKAAQKVRDEFNGNFPTNFEQVWALSGVGRSTAGAILSSVLNQPYPILDGNVKRVLARYFAVEGWSGEKKVENRLWALTEQVTPTTRVADFNQAMMDIGAMVCMRTKPKCDLCPLNIDCLAYKNTNWEKFPAKKPKKAMPEKTTYFLILSKNGKVCLEQRENSGLWGGLFCFPQFEDKSSLLHFLAQEKVTHYQEWPSFRHTFSHFHLDIHPIYAEMESTLCVEQANLDWRKVMESTKEYQSNLSSAVKYWYDPQNPEPIGLAQPVKNLLIQFVRNHYGKNSIL

43.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mutY using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here