Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.

Belongs to the AB hydrolase superfamily. AB hydrolase 2 family.

222 amino acids

MSNLIEIKSKSTHTATVIFLHGLMDTGKGWETRMENIISMGGLDHIKFVLPTAPTIPISINFGNKGTAWCNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKNGIPAERIILSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLSLPSKIKPENKDIPLTMFHGTDDKVVNCKWGELSHKSYLKVGIKNSQFISITNLDHSSNEFELKQVHDLIEKYLPK

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DDB_G0268064 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here