Involved in the biosynthesis of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell.

Belongs to the transferase hexapeptide repeat family. LpxA subfamily.

271 amino acids

MNVALIDPTARVADGAWLADDVEVGPYCIVGPDVTLEDGVRLHAHVNVQGVTTLGARTQVYPFASLGTPPQSVHYKGEKTSLVVGTDCQIREHVTMNTGTASGRGVTRVGNNCMLMTAAHVAHDCLVGDNVIFANNATLGGHVEVGDNVFLGGLSAVHQFVRIGAQVMIGGVTGVREDVIPFGYAIGQNANLVGLNVVGMKRRGFSKSELHAARAAYRDLFFGEGTFAERLAGLRERQDASPFIKALVSFVDAGGKRALCHPSRGVVAQED

28.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make lpxA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here