Protein expression services for ALT3 | Acyl-acyl carrier protein thioesterase ATL3, chloroplastic
Description
Acyl-ACP thioesterase involved in the production of fatty acids and beta-keto fatty acids. Can produce fatty acids of long chain (14:1 and 16:1) and beta-keto fatty acids of medium to long chain (8:0, 10:0, 12:0, 12:1, 14:0 and 16:0) when expressed in a heterologous organism (E.coli). Possesses thioesterase activity for lauroyl-ACP (12:0-ACP) in vitro. May play a role in the generation of long fatty acids in the chloroplast.
Family
Belongs to the 4-hydroxybenzoyl-CoA thioesterase family.
Species
Arabidopsis thaliana
Length
190 amino acids
Sequence
MFLQVTGTATPAMPAVVFLNSWRRPLSIPLRSVKTFKPLAFFDLKGGKGMSEFHEVELKVRDYELDQFGVVNNAVYANYCQHGRHEFLESIGINCDEVARSGEALAISELTMKFLSPLRSGDKFVVKARISGTSAARIYFDHFIFKLPNQEPILEAKGIAVWLDNKYRPVRIPSSIRSKFVHFLRQDDAV
Mass
21.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ALT3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here