Acyl-ACP thioesterase involved in the production of fatty acids and beta-keto fatty acids. Can produce fatty acids of medium to long chain (12:0, 14:1, 14:0, 16:1 and 16:0) when expressed in a heterologous organism (E.coli). Possesses thioesterase activity toward lauroyl-ACP (12:0-ACP) in vitro. May play a role in cuticular wax synthesis.

Belongs to the 4-hydroxybenzoyl-CoA thioesterase family.

189 amino acids

MLKATGTVAPAMHVVFPCFSSRPLILPLRSTKTFKPLSCFKQQGGKGMNGVHEIELKVRDYELDQFGVVNNAVYANYCQHGQHEFMETIGINCDEVSRSGEALAVSELTIKFLAPLRSGCKFVVKTRISGTSMTRIYFEQFIFKLPNQEPILEAKGMAVWLDKRYRPVCIPSYIRSNFGHFQRQHVVEY

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ALT1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here