Binds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl-CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism.

Belongs to the ACBP family.

92 amino acids

MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAASKAST

10.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ACBP6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here