Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has a preference for arachidyl alcohol as well as decyl alcohol, demonstrating its relatively poor activity using saturated long chain alcohols (C16, C18, and C20) (By similarity).

Belongs to the diacylglycerol acyltransferase family.

328 amino acids

MSCSMKTEHLQSLSLLQWPLSYVAMFWIVQPLLICLLFTPLWPLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVWNHIRDYFPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPIIRDYIMAKGLCSVSQASIDYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLLLKKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDCKGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQKLIFL

37.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Awat1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here