On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin (By similarity).

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.

504 amino acids

MALPVLLLLLALPSRSVQDEELKLNECVCEGMSCGNGDRCQGQQCFASLSINDGAKVYQKGCFQVYEQGKMTCKTPPSPDQAVECCQGYLCNMNITAKLPSSKGQTLQGEAAGYSMETLIIVILAPVVVLVIFSVVAVLIIRRIQKNHMERLNSRDAEYGTIEGLIASNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLVECVGKGRYGEVWRGQWQGENVAVKIFSSRDEKSWFRETELYNTVLLRHENILGFIASDMTSRNSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAISHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQADCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDLVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKADC

56.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ACVR1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here