Description
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin (By similarity).
Family
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
Sequence
MALPVLLLLLALPSRSVQDEELKLNECVCEGMSCGNGDRCQGQQCFASLSINDGAKVYQKGCFQVYEQGKMTCKTPPSPDQAVECCQGYLCNMNITAKLPSSKGQTLQGEAAGYSMETLIIVILAPVVVLVIFSVVAVLIIRRIQKNHMERLNSRDAEYGTIEGLIASNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLVECVGKGRYGEVWRGQWQGENVAVKIFSSRDEKSWFRETELYNTVLLRHENILGFIASDMTSRNSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAISHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQADCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDLVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKADC
Simulated SDS-PAGE
![Western blot of ACVR1 recombinant protein](/recombinant/ACVR1-5.png)
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service