About Products Protein Database Contact

Protein expression services for ARPC2A | Actin-related protein 2/3 complex subunit 2A

Description
Functions as actin-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the mother actin filament (By similarity). Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development.
Family
Belongs to the ARPC2 family.
Species
Arabidopsis thaliana
Length
318 amino acids
Sequence
MILLQSHSRFLLQTLLTRAQNLDKAVELDYQWIEFDDVRYHVQVTMKNPNLLLLSVSLPNPPPEAMSFDGLPLGAIEAIKTTYGTGFQILDPPRDGFSLTLKLNFSKVRPDEELLTKLASIREVVMGAPLKIIFKHLASRTVAPELDRLVAIMHRPNETFFLVPQADKVTVAFPMRFKDSVDTILATSFLKEFVEARRAAALNTAPSCSWSPTAPQELEGAPKETLSANAGFVTFVIFPRHVEGKKLDRTVWNLSTFHAYVSYHVKFSEGFMHTRMRRRVESMIQALDQAKPLEKTRSMNNKSFKRLGLNEVNHTNSK
Mass
36 kDa
Simulated SDS-PAGE
Western blot of ARPC2A recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ARPC2A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here