Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. The Arp2/3 complex is involved in organizing the actin system in cell motility and chemotaxis, in phagocytosis and macropinocytosis, at late steps of endosome processing, and in mitosis. In concert with a group of other proteins, the Arp2/3 complex plays a general role in the rapid activation and adaptation of the actin system to its multiple functions.

Belongs to the WD repeat ARPC1 family.

369 amino acids

MSAFEIEHLASCITAHAWNADRSRVALCPNNNEVHIYAKQGTSWVVEHVLAEHDQLVTSIDWAPKTNRILTSSQDRNAYVWTFKDGQWKPVLVLLRINRAATHVKWSPQENKFAVATGAKLVCICFFEEEHDWWASNHIKKHKSTVLKVDWHPNNLLLATSSSDYKVRVFDAYIKKADGRSVTRPYGEVAFGEPVFEFDQCASWVHALKWSPSGSTLAYSSHDGVFAVANFSTNPPTIEKLRVRNLPLRDLLYITENSIAGVGYDCAPLLITNQNGWKYSGEMDKASEGGAAAGSETSARKLFQNKVDLGESKSADKKLTTVHQNCITSIVPFKSVGGVVSDFSTSGLDGNIVVWHVKALEAKNKFKVI

41.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arcA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here