Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers. Binds monomeric actin (G-actin) with a marked preference for the ADP-loaded form and inhibits the rate of nucleotide exchange on G-actin. Required for pollen tube growth. Promotes turnover of longitudinal actin cables by severing actin filaments in pollen tubes.

Belongs to the actin-binding proteins ADF family.

137 amino acids

MANAASGMAVEDECKLKFLELKSKRNYRFIIFRIDGQQVVVEKLGNPDETYDDFTASLPANECRYAVFDFDFITDENCQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPSEMSFDIIKSRAL

15.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ADF7 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here