Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (PubMed:19346440, PubMed:22010035). Contributes to the stochastic dynamic turnover of actin filaments (PubMed:22010035). Binds monomeric actin (G-actin) with a marked preference for the ADP-loaded form and inhibits the rate of nucleotide exchange on G-actin. Involved in resistance triggered by the effector AvrPphB of Pseudomonas syringae pv tomato (Pst). May modulate the AvrPphB-RPS5-mediated defense signal transduction pathway (PubMed:19346440). During AvrPphB-triggered resistance signaling pathway, involved in the control of MPK3 and MPK6 activaton, via the coordinated regulation of actin cytoskeletal dynamics and RPS5 resistance gene transcription (PubMed:23144618). During innate immune response triggered by the bacterial elf26 peptide, the inhibition of ADF4 regulates actin dynamics in order to execute key events associated with pattern-triggered immunity (PTI), such as cell wall fortification and transcriptional activation of defense gene markers (PubMed:24464292).

Belongs to the actin-binding proteins ADF family.

139 amino acids

MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVLKSRVN

16 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ADF4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here