Actin-depolymerizing protein. Stimulates F-actin depolymerization. Involved in plant development, cell organ expansion and flowering by controlling breakdown of thick actin cables (PubMed:11402164). Severs actin filaments or bundles and promotes actin cytoskeleton disassembly (PubMed:21570971). Binds monomeric actin (G-actin) with a marked preference for the ADP-loaded form and inhibits the rate of nucleotide exchange on G-actin (PubMed:17538023).

Belongs to the actin-binding proteins ADF family.

139 amino acids

MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFRSRAN

16.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ADF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here