About Products Protein Database Contact

Protein expression services for end3 | Actin cytoskeleton-regulatory complex protein end3

Description
Component of the PAN1 actin cytoskeleton-regulatory complex required for the internalization of endosomes during actin-coupled endocytosis. The complex links the site of endocytosis to the cell membrane-associated actin cytoskeleton. Mediates uptake of external molecules and vacuolar degradation of plasma membrane proteins. Plays a role in the proper organization of the cell membrane-associated actin cytoskeleton and promotes its destabilization (By similarity).
Family
Belongs to the END3 family.
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
375 amino acids
Sequence
MDPQEKNKYWEIFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLINGVYKTVPDRVPEALVSTSKKHLVAARDALRGNDDIALLHKVPSLDTDPEDAVLKDGFDWYISPSDKIRYSDIYSLHCNKHGEVSFNGLAPVFTPFGVPNSQIQKAWKLVNPQGTETIQKDQCLVFLHILTQRSNGFRIPNDVPYSLKASFKRGNIDYNLDSYNSTNNYYSSPTMAPSTGGAKPKSDLDAPRDVRDSDWELISLRNELSKLDEKILSLQRETDDVNIAQNKSKLIQRDLQKVLDYKLGILQSLKNDGPNGPSASAIDNDLKMLEQQLNVLGRHLEGRKSQVAKLEERLRSLS
Mass
42.2 kDa
Simulated SDS-PAGE
Western blot of end3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make end3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here