Component of the PAN1 actin cytoskeleton-regulatory complex required for the internalization of endosomes during actin-coupled endocytosis. The complex links the site of endocytosis to the cell membrane-associated actin cytoskeleton. Mediates uptake of external molecules and vacuolar degradation of plasma membrane proteins. Plays a role in the proper organization of the cell membrane-associated actin cytoskeleton and promotes its destabilization (By similarity).

Belongs to the END3 family.

404 amino acids

MSTKKIEQWEIERYWEIFASLSNGQPHLNSSQAASVLRNSRLRDEQLEKVWDLADVDGDGELDFEEFCVAMRLVFDLVNGELQEVPRVLPDWLVPESKAHLVQAGRALSGRPEQFERIEDEDDTPGLKDGFDWYMNPADKSKYEEIYSANRNHRGEVTFESLQGLYDSLDVPDTDVRSAWNLVNPSASPAINKDATLAFLHILNYRHEGFRIPRTIPASLRASFENNKIDYQVDNARPAQKWGADGSTETLTGRKTKFGDTYLSRLGVGGKGSYTPKGTDFSDTIQDEEWEKVRLRRELAEMEAKLDAANKASEGRRDRPRNDGRPNWVLIKKEALQLLEYKERELRELREGTGRAKEGQDLERLRDDIKTVGDQVEGLKAHLAERKDVLADVRRQIEEERLHR

46.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make end3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here