Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.

Belongs to the acireductone dioxygenase (ARD) family.

188 amino acids

MSRLTVYRDDAPDTILLDVTTPGEIAETLRPHNIRFDRWSAPITPAPDAPAEEVLDAYRPYLDTLMGETGAGSADVVRINASTPNLPELRKKFLSEHTHSEDEVRFFVHGQGAFVLHIRGRVYSVLCTQGDLISVPAGIPHWFDAGPSPDVVALRVFTDTTGWIAQYTGDDIANRFPAEVPVEASGNS

20.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make mtnD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here