About Products Protein Database Contact

Protein expression services for mtnD | Acireductone dioxygenase

Description
Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.
Family
Belongs to the acireductone dioxygenase (ARD) family.
Species
Pseudomonas syringae pv. syringae (strain B728a)
Length
181 amino acids
Sequence
MSSLSVYHVSSPDMPNKVLTHLEDIASTLAEHGVAFDRWEAATPITPGASQEEVISAYRTQIDTLMTERGYVTVDVISLNSDHPQKAELRARFLEEHRHGEDEVRFFVAGRGLFTLHIDDYVYAVLCEKNDLISVPAGTRHWFDMGENPHFVAIRLFNNPEGWVANFTGEDIAGRFPRLED
Mass
20.5 kDa
Simulated SDS-PAGE
Western blot of mtnD recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make mtnD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here