Description
Catalyzes 2 different reactions between oxygene and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway.
Family
Belongs to the acireductone dioxygenase (ARD) family.
Species
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Sequence
MSSLTVYHENQPEQPLKLLTHAEDIASTLAEVGVRFERWEAAAPIAAGASQDEVIAAYAHEIERLKRERGYITVDVVSLNSDHPQKAELRAKFLDEHRHGEDEVRFFVAGRGLFVLHIEEHVYAVLCERNDLISVPAGTRHWFDMGEHPHFVAVRLFNNPEGWVAQFTGDDIASRFPLLED
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service