Proton-gated sodium channel; it is activated by a drop of the extracellular pH and then becomes rapidly desensitized. Generates a biphasic current with a fast inactivating and a slow sustained phase. Has high selectivity for sodium ions and can also transport lithium ions with high efficiency. Can also transport potassium ions, but with lower efficiency. It is nearly impermeable to the larger rubidium and cesium ions.

Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ASIC1 subfamily.

522 amino acids

MDLKADSEDVDYKQPAPIEDFASRSTLHGISHMFTYERVCIKRTLWILFFLGSVGALALVCVDRVQFYFQYPHVTKLDEVAAPLMTFPAVTFCNLNSFRFSRVTRNDLYHAGELXALLNGRYEIRDTHLVEENVLEILKERANFDNYKPRPFNMREFYDRTGHDIKDMLLSCYYRGVECNAENFKVIFTRYGKCYTFNSGKDGRPLLLTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQSEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKAAPMDSDFFSTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCKTPCNLTRFGKEMSFVKIPSKASAKYLAKKFXKTEQYIADNILVLDIYFDALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVLKYKLCRCVKKKHKGRGNKDRGAVLSLDDVKRHAPCENLRTPSTYPGNMLPHHPGQGNFEDFTC

59.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make asic1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here