Transcriptional regulator. May mediate transcription activation by binding to the E box-containing promoter (By similarity). Involved in neurogenesis. Involved in maintaining rhombomere boundaries in the hindbrain, probably via up-regulation of delta expression. May mediate transcription activation by binding to the E box-containing promoter.

195 amino acids

MEATVVATTQLTQDSFYQPFSESLEKQDRECKVLKRQRSSSPELLRCKRRLTFNGLGYTIPQQQPMAVARRNERERNRVKQVNMGFQTLRQHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAVLQCGVPSPSVSNAYSAGPESPHSAYSSDEGSYEHLSSEEQELLDFTTWFDRYESGASMATKDWC

22.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ascl1b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here