About Products Protein Database Contact

Protein expression services for ascl1 | Achaete-scute homolog 1

Description
Transcription factor that plays a key role in neuronal differentiation: acts as a pioneer transcription factor, accessing closed chromatin to allow other factors to bind and activate neural pathways (By similarity). Directly binds the E box motif (5'-CANNTG-3') on promoters and promotes transcription of neuronal genes (PubMed:8443105). The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro (By similarity).
Species
Xenopus laevis
Length
199 amino acids
Sequence
MDNCVAAKIMDSNLSSQQQHFLQPHCFFPQNVQQLSPAEEQQASKAKPIKRQRSASPELMRCKRRLNFNGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQSGVLSPTISPNYSHDMNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTTWF
Mass
22.4 kDa
Simulated SDS-PAGE
Western blot of ascl1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ascl1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here