Catalyzes the transfer of an acetyl group from acetyl coenzyme A (AcCoA) to an acceptor substrate and releases both CoA and the acetylated product. It prefers the antibiotic chloramphenicol.

186 amino acids

MSNVQNASRSSAFAAVEGDHWVESLDDGRHVLIRPLREEDRERERQFINRLSPATRHFRFLGEIKEASPALLDQLMDIDYQQSMAFVALVHEDGELREVGISRYAACCEEGQCECAVTIADDYQGLGLDAVLMRHLIDVARRNGFRQMYSVDSAANRAMRDLCCALGFVGQRDPDDSTQVIHRLAL

21 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PA5475 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here