Catalyzes the ATP-dependent phosphorylation of N-acetyl-L-glutamate.

Belongs to the acetylglutamate kinase family. ArgB subfamily.

304 amino acids

MPKIHDSSCTSGLTPSQRSHVLAEALPWLLHYRDKIVVVKYGGNAMIDDELKRAFAADMVFLRAVGARPVVVHGGGPQINMMLDKVGLEGEFRGGFRVTSPEVMEYVRMVLFGKVGRELVGLINEHGPYAVGASGEDAGLFTAEKFQPEIEGELVDIGRVGSITDVDPTSLFDLIDAGRIPVVSTIAPDDDGLVYNINADTAAGALAGALDAERLVMLTNVPGLYTDWPNKDSLVSSLTPAELEELLPTLDSGMIPKMTACLDAIHNGVKAAHVIDGRVPHSVLLELMTEGGIGTMISSESYEH

32.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make argB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here