Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA.

Belongs to the AccA family.

323 amino acids

MKTTFLDFEQPIAELEAKIEELRFVQDDSAVDISEEIERLSKKSQQLTKDLYTNLTPWQVSQIARHPQRPYTQDYINELFTDFHELHGDRSFADDLSIVGGLARFNGQPCMVIGHQKGRDTKERALRNFGMPRPEGYRKAERLMRLAEKFGLPLFTFIDTPGAYPGIGAEERGQSEAIGRNLYVMAELKTPIISTVIGEGGSGGALAVAVADSVLMLQFSTYSVISPEGCASILWKSAAKAPEAAEALGLTAHRLKALGLIDKIVSEPLGGAHRDPKGMAAMLRRALADSLRQFHGMSTNDLRQRRFDRLMAYGKFKETTPGA

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make accA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here