Deacetylates 17-O-acetylajmaline and 17-O-acetylnorajmaline, but is inactive toward other acetylated alkaloids.

Belongs to the 'GDSL' lipolytic enzyme family.

387 amino acids

MGFARLLHLVFSLLVFAGITNGLICPFDSIYQLGDSFSDTGNLIRLPPDGPTFTAAHFPYGETFPGTPTGRCSDGRLIIDFIATALNLPLLNPYLQQNVSFRHGVNFAVAGATALDRSFLAARGVQVSDIHSHLSAQLNWFRTYLGSICSTPKECSNKLKNALFILGNIGNNDVNYAFPNRTIEEIRAYVPFITEAVANATREIIRLGGSRVIVPGIFPIGCVARNLNFLNFFPDGDKDDLGCLSSLNNLSIYFNSLFQRALASLSIEFPQAVIIYADYYNAWRFLFRNGPALGSNSTSLLKCCCGIGGPYNYDPDRECGSRGVPVCPNPTQYIQWDGTHFTQAAYRRVAEYVIPGIIKALKCSYSNIQPFLREGEGRQALRLNERE

42.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AAE using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here