Catalyzes the carboxylation of acetophenone to form 3-oxo-3-phenylpropanoate (benzoylacetate) in the anaerobic catabolism of ethylbenzene. Also carboxylates propiophenone at the same rate and 4-acetyl-pyridine at lower rates.

129 amino acids

MYERIRFTEYLDLDLNDEHWYCHDCGTKLISARESYKKGCLVAERRPHEIHNPVIEGEYSFAPDENWVRILEFYCPGCTRQIETEYLPPGHPITVDIEVDIDSLKARLKKGVIVIKDGKLTKPEAEVLA

15 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make apc2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here