Catalyzes the reversible formation of acetate and ATP from acetyl-CoA by using ADP and phosphate. Can use other substrates such as phenylacetyl-CoA, indoleacetyl-CoA and isobutyryl-CoA, but not succinyl-CoA. Seems to be involved primarily in the degradation of aryl-CoA esters to the corresponding acids. Participates in the conversion of acetyl-CoA to acetate and in the degradation of branched-chain amino acids via branched-chain-acyl-CoA esters.

Belongs to the acetate CoA ligase alpha subunit family.

457 amino acids

MLDYFFNPRGIAVIGASNDPKKLGYEVFKNLKEYQGGKVYPVNVREEEVQGVKAYKSVKEIPGEVDLAIIVVPKKFVKQTLIECGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGMRIIGPNCVGIMNTHANLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNMADLDFADLMEYLADTQEDKAIALYIEGIKDGRRFIEVAKKVTKKKPVIALKAGKSESGSRAAASHTGSLAGSWKIYEAAFKQSGVLVANTIDEMLSMARAFTQPLPKGNRVAIMTNAGGPGVLTADEIDKRGLKLANLEEKTIEELRSFLPPMAAVKNPVDMIASARGEDYYRTAKLLLQDPNVDILIAICVVPTFAGMTPTEHAEGIIRAVKEVNNGKPVLALFMAGYVSEKAKELLEKNGIPTYERPEDVAAAAYALVQQAKNVGGGVNG

49.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make acdAII using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here