Catalyzes the formation of acetyl phosphate from acetate and ATP. Can also catalyze the reverse reaction.

Belongs to the acetokinase family.

398 amino acids

MSKTIAVNAGSSTVKFKLFDMPSEEVVAEGNIERIGMDMGHAKIKYGDGQVSEEEKPFPNHGTAVSYLLDQLINLGIVKEYHEITAVGHRIVAGGEFFKDSVVIDDDVMQKIDELAEYAPLHNPAELQGIKAFKRVLPDAFAVAVFDTSFHSNMPEMNALYSVPYEWYEKYGARKYGAHGTSHRYVASRAAEMLGKPLEDLKLITCHIGAGASITAIKNGKSFDTSMGFSPLAGVTMATRSGDVDPSLVAFVQSKLGISSEEMIELLNHKSGLLGLSELSADMRDVQAAAEHGNKQCELALEIYENRVLKYIGSYLAELGGADAIVFTAGVGENDKEFRQAIGDKLAYFGVKVDPEKNDVRGEERDVSADDAKIKVLLIPTNEELMIVHDIERLRKQA

43.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ackA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here