Essential for the production of a quorum sensing system signal molecule, the autoinducing peptide (AIP). This quorum sensing system is responsible for the regulation of the expression of virulence factor genes. Involved in the proteolytic processing of AgrD, the precursor of AIP.

Belongs to the AgrB family.

187 amino acids

MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQIIVGNFFKILVTYSISIFLSVFLFTLVTHLSYMLIRYNAHGAHAKSSILCYIQSILTFVFVPYFLINIDINFTYLLALSIIGLISVVIYAPAATKKQPIPIKLVKRKKYLSIIMYLLVLILSLIIHPFYAQFMLLGILVESITLLPIFFPKED

21.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make agrB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here