Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (PubMed:25336567). Encodes a nuclear matrix protein that acts in the maintenance of genomic integrity by silencing TEs and repeat-containing genes through epigenetic machinery. Acts as a chromatin remodeling factor that modifies the architecture of FLC and FWA chromatin by modulating both H3 acetylation and methylation leading to the regulation of FLC and FWA expression (PubMed:23394836, PubMed:23836195). Negatively regulates floral repressors including MAF4 and MAF5 (PubMed:23733063). Plays a transcription activation role in anther development. Regulates the expression of arabinogalactan proteins (AGPs) involved in the formation of the nexine layer of the pollen wall (PubMed:25336567, PubMed:24804694). Binds AGP6, AGP11, AGP23 and AGP40 promoters (PubMed:25336567).

257 amino acids

MAGGTALTPTSVGSKSVPMRNHEATERGNTNNNLRALPKAVQPVSSIEGEMAKRPRGRPAGSKNKPKPPIIVTHDSPNSLRANAVEISSGCDICETLSDFARRKQRGLCILSANGCVTNVTLRQPASSGAIVTLHGRYEILSLLGSILPPPAPLGITGLTIYLAGPQGQVVGGGVVGGLIASGPVVLMAASFMNAVFDRLPMDDDEAASMQNQQYYQNGRSRPLDDIHGLPQNLLTNGNSASDIYSWGPAQRVMSKP

27 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AHL16 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here