ATP-dependent RNA helicase which is a core component of a variety of ribonucleoprotein complexes (RNPs) that play critical roles in translational repression and mRNA decapping during embryogenesis, oogenesis, neurogenesis and neurotransmission (PubMed:11546740, PubMed:16256742, PubMed:17178403, PubMed:18590813, PubMed:21267420, PubMed:21447556, PubMed:28875934, PubMed:28388438, PubMed:17982591). Recruits core components and translational repressors to some RNP complexes, and mediates RNP aggregation into processing granules such as P-bodies (PubMed:28875934, PubMed:11546740, PubMed:16256742, PubMed:17178403, PubMed:21267420, PubMed:21447556, PubMed:17982591). As part of a RNP complex containing tral, eIF4E1, cup, and pAbp, involved in RNP-mediated translational repression of maternal mRNAs during oogenesis and embryogenesis (PubMed:28875934). As part of a RNP complex containing tral and the RNA localization factors exu and yps, mediates translational silencing of mRNAs such as osk/oskar and bcd/bicoid during their transport to the oocyte in order to prevent their translation until they reach their positional destinations (PubMed:11546740). In neurons and possibly imaginal disks, involved in miRNA-mediated translational repression, possibly in association with components of the piRNA transposon silencing pathway (PubMed:21447556, PubMed:17178403, PubMed:21267420, PubMed:17982591, PubMed:21081899). Involved in RNA localization and protein trafficking in the oocyte (PubMed:11546740, PubMed:16256742). As part of an ER-associated RNP containing tral, cup and yps, required for tral-dependent ER exit site formation and consequently efficient trafficking of proteins such as grk and yl through the secretory pathway (PubMed:16256742). Component of neuron RNPs that mediate transport and translation of neuronal RNAs, including translation repression of synaptic transcripts in preparation for their dendritic targeting (PubMed:17178403, PubMed:21267420, PubMed:28388438). As part of the Atx2-Not1 repressor complex promotes Not1-dependent post-transcriptional gene silencing in adult circadian pacemaker neurons in order to sustain high-amplitude circadian rhythms and Pdf cycling in a per-independent manner (PubMed:28388438). Promotes the interaction between Atx2 and Not1 within the Atx2-Not1 RNP complex (PubMed:28388438).

Belongs to the DEAD box helicase family. DDX6/DHH1 subfamily.

459 amino acids

MMTEKLNSGHTNLTSKGIINDLQIAGNTSDDMGWKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQTSQICIELAKHLDIRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHCRILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVANVGASVGDTCNNSDLNNSANEEGNVSK

51.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make me31B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here