ATP-binding RNA helicase involved in transcription elongation and required for the export of mRNA out of the nucleus. SUB2 plays also a role in pre-mRNA splicing and spliceosome assembly. May be involved in rDNA and telomeric silencing, and maintenance of genome integrity (By similarity).

Belongs to the DEAD box helicase family. DECD subfamily.

441 amino acids

MSHEGEEELLDYSDSEEIALPSTTVESGSNGDAKAETTTVKEENTEQKGSYVGIHSTGFRDFLLKPELLRAIVDCGFEHPSEVQQVCIPQSILGTDVLCQAKAGVGKTAVFVLSTLQQLEPVPGECSVVVLCHTRELAYQIMNEYARFSKYLPDVKTAVFYGGSPIQKDIELIQNKETSPHVIVATPGRLHALVRDKHLRLGNVKTFVIDECDKVLDQIDMRRDVQEIFRVTPRQKQVMMFSATLSQEIRPICKKFMSSPLEILVDDEGKLTLHGLQQYYVDVEEKSKNRKLGDLLDNLEFNQVIIFVKSTSRANGLSQVLNANGFPCTAVHSGIPQEERIARYKEFKEFKKRICVSTDVFGRGIDIERINLAINYDLPAEADQYLHRVGRAGRFGTKGLAISFVSTPEDKEVLAKIQERFEVNIAPYPAEGVDPSTYMNS

49.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make SUB2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here