ATP-dependent RNA helicase involved in 40S ribosomal subunit biogenesis. Required for the processing and cleavage of 35S pre-rRNA at sites A0, A1, and A2, leading to mature 18S rRNA (By similarity).

Belongs to the DEAD box helicase family. DDX48/FAL1 subfamily.

398 amino acids

MSFNRDDDSKLKFKTSKKLKVSATFESMNLKPDLLRGIYFYGFEYPSSIQSRAISQIISGKDVIAQAQSGTGKTATFTIGLLQAIDSKSKELQALVLSPTRELASQSESVISNLGDYLNVTAHACTGGKALQQDIKKVSKNCQVVSGTPGRVLDMIKRQVLNVRNCKILVLDEADELLGETLGFKQQIYDIFTKLPPTIQVVVVSATMSKDILEITKKFMSDPVKILVKRDEISLDVIKQYYVDVEKEEWKFDTLCDLYDSLTITQCVIFCNTRKKVDWLSRKLTQTNFSVSSMHGDMKQEERDQVMNDFRSGKARVLISTDVWARGIDVQQISLVINYDIPDNLENYIHRIGRSGRFGRKGVAINFITKEERPKLKEIESHYRIKIKPTPANLEELS

45 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FAL1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here