ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis. Involved in efficient pre-rRNA processing, predominantly at site A3, which is necessary for the normal formation of 25S and 5.8S rRNAs (By similarity).

Belongs to the DEAD box helicase family. DDX5/DBP2 subfamily.

592 amino acids

MGKRPIEDDAVASSELSRKKSKKEKSGKSKKSVIGEGADTNGHAPAAETTVDGSENEALSKAERKAAKKAKKEAKEASKAGKADAPTVENDEEAAKAARKAARKAEKKKLKEAEKTASSAPTEASSVPAQTLSSSNAGSYTEHTELAQLPQSEIDAFLTKNTMTIEDPKPAARKLRPIVNFKYLPVTDESQRAPFAGFTAPTPIQAATWPFLLSGRDMVGVAETGSGKTLAFGVPCVRAILSLPKDKRKGIKAVIVSPTRELAVQIYDQLVALAHPAGLSVVCVYGGVPKDPQVAACRKAHIVVATPGRLNDLIGDGSADLSNADYVVLDEADRMLDKGFEEPIRQIISQTPKKRQTLMFTATWPPSVRDLASTFMVSPVRITIGDNQSGELRANVRIKQLVEVLDPHAKEQRLLQLLKQYQSGKNKDDRILVFCLYKKEAMRIENFIRMKGFRVGGIHGDLSQEKRSASLAAFKEGQVPLLVATDVAARGLDIPAVKLVINVTFPLTAEDYVHRIGRTGRAGKEGLAITFFTEHDKGLSGSLINVLKAANQEVPEELLKFGTTVKKKEHGAYGAFYKDVDNTKAATKITFD

64 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DBP3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here