Structural subunit of pyrophosphate--fructose 6-phosphate 1-phosphotransferase. Not required for catalytic activity. Fine-tunes allosteric regulation of the ATP-PFK by ATP, fructose 2,6-bisphosphate and AMP (By similarity).

351 amino acids

MVTKESIISDLEKENVGPEFGEFLNSLQTDLNSEKPLIEQVKSQLETHFNLGPETQEFSRKNDNAPVDQLLTNYYNNYEVNVLEFVLQMGFCKDLSIPLNVWFVLDMISQLSTSKQDLPLDYYLVLNNSHTGKYSDFVRYLIYEAVGAEIHCFEQGDMPQQYRSSRWEDKVKGPALANRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEMSDRSFVTLLLDYYQRVGTTKKIDLLLLTNNYDTNMNNKLQQLKILESLNMLKSNCYVLDYQITADQVTANFNSYVEGIPAFRRHEIANFLKKRRTPKNADELIFKYVGRWNICYQKKFHQGNISIHQISGYLD

40.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PFK3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here