About Products Protein Database Contact

Protein expression services for GET3 | ATPase GET3

Description
ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting.
Family
Belongs to the arsA ATPase family.
Species
Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Length
349 amino acids
Sequence
MTDITPEASLRSLINSTTHKWIFVGGKGGVGKTTSSCSIAIQMALAQPTKQFLLISTDPAHNLSDAFNEKFGKDARKVTGMDNLSCMEIDPSAALKDVNDMAIANGGDDDGLSGLLQGGALADLTGSIPGIDEALSFMEVMKHIKKQEQGDGEHFDTVIFDTAPTGHTLRFLQLPTTLTKVLDKFGAIAGRLGPMLNSFAGNPNVDVLGKMNELKESVQKIKKQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAESDKEHNCKRCQARWKMQKKYLSQIDELYEDFHIVKMPLCAGEIRGLENLKKFSCFLNNKYDPETDGELVYQLEQGL
Mass
38.6 kDa
Simulated SDS-PAGE
Western blot of GET3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GET3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here