ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting.

Belongs to the arsA ATPase family.

325 amino acids

MEPTLKNILENPSLKWIFVGGKGGVGKTTTSSSLATLFAKSGKKTIIISTDPAHNLSDCFDQKIGGQPILIKGIDNLSAMEIDPTVDPDKLKLPTLQGFMNDQATKSLLSELISSVPGIDEAMSFAELMNSVDEMKYDLIIFDTAPTGHTLRLLNFPNIMEKGLNKLVQLRYNFQNLASQFQGLFGSQEEFDQQMNQMFSKIETMKDTVTKVNAQMKDKNKTTFIGVCIPEFLSMYETERLVQELTKFKIDIHNIVINQVLFPDDQCKMCNARAKMQKKYLDQMIDLYDDFHVVIMPLQENEVRGIDGLKQFCELLLKPKTVPQV

36.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Have you tried producing GSPATT00023900001 in a cell-free protein expression systems? We have solved cell-free protein expression scale-up and purification challenges so that you can obtain up to low-milligram quantities of proteins in hours.

Order Here