About Products Protein Database Contact

Protein expression services for MT-ATP8 | ATP synthase protein 8

Description
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane (By similarity).
Family
Belongs to the ATPase protein 8 family.
Species
Orycteropus afer
Length
67 amino acids
Sequence
MPQLDTTPWFITILSMIITLFILFQSNMSKYLYPLEPQPKTLKTQLYNAPWETKWTKIYLPHSLHLH
Mass
8.1 kDa
Simulated SDS-PAGE
Western blot of MT-ATP8 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MT-ATP8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here