About Products Protein Database Contact

Protein expression services for Arl6ip1 | ADP-ribosylation factor-like protein 6-interacting protein 1

Description
Positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. Promotes the catalytic efficiency of SLC1A1/EAAC1 probably by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport (PubMed:18684713). Plays a role in the formation and stabilization of endoplasmic reticulum tubules. Negatively regulates apoptosis, possibly by modulating the activity of caspase-9 (CASP9). Inhibits cleavage of CASP9-dependent substrates and downstream markers of apoptosis but not CASP9 itself. May be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation (By similarity).
Family
Belongs to the ARL6ip family.
Species
Mus musculus
Length
203 amino acids
Sequence
MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMTMIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
Mass
23.4 kDa
Simulated SDS-PAGE
Western blot of Arl6ip1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Arl6ip1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here