About Products Protein Database Contact

Protein expression services for ARL4D | ADP-ribosylation factor-like protein 4D

Description
Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form (By similarity).
Family
Belongs to the small GTPase superfamily. Arf family.
Species
Bos taurus
Length
200 amino acids
Sequence
MGNHLTEMAPTTSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSIPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELATATLTHVQGCSAVDGLGLQPGLERLYEMILKRKKAARAGKKRR
Mass
22.1 kDa
Simulated SDS-PAGE
Western blot of ARL4D recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ARL4D using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here