Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Required for targeting proteins to the ciliary membrane by releasing myristoylated protein from unc119 cargo adapters into the cilium.

Belongs to the small GTPase superfamily. Arf family.

177 amino acids

MGLLSLIRGLKKKEGEARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWDIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMTGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLKEGMEWMMKQVK

19.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ARL3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here