Removes ADP-ribose from asparatate and glutamate residues in proteins bearing a single ADP-ribose moiety. Inactive towards proteins bearing poly-ADP-ribose. Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Plays a role in estrogen signaling. Binds to androgen receptor (AR) and amplifies the transactivation function of AR in response to androgen. May play an important role in carcinogenesis and/or progression of hormone-dependent cancers by feed-forward mechanism that activates ESR1 transactivation. Could be an ESR1 coactivator, providing a positive feedback regulatory loop for ESR1 signal transduction. Could be involved in invasive growth by down-regulating CDH1 in endometrial cancer cells. Enhances ESR1-mediated transcription activity.

323 amino acids

MSLQSQVSGRLAQLRAAGQLLVSLRPWPGRSAGGPRPRGSACGPLVALGEHGYCAWLSAGVGAWGAAGRGAWVRTWAPLAMAAKVDLSTSTDWKEAKSFLKGLSDKQREEHYFCKDFIKLKKIPTWKETAKGLAVKVEDPKYKKDKQLNEKISLYRGDITKLEVDAIVNAANSSLLGGGGVDGCIHRAAGSLLTDECRTLQNCETGKAKITCGYRLPAKYVIHTVGPIAVGQPTASQAAELRSCYLSSLDLLLEHRLRSVAFPCISTGVFGYPNEEAAEVVLASLREWLEQHKDKVDRLIICVFLEKDEGIYRERLPHYFPVA

35.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Macrod1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here