Mediates the hydrolyzis of oxidized nucleoside diphosphate derivatives. Hydrolyzes 8-oxo-7,8-dihydroguanine (8-oxo-Gua)-containing deoxyribo- and ribonucleoside diphosphates to the monophosphates. Hydrolyzes 8-oxo-dGDP and 8-oxo-GDP with the same efficiencies. Hydrolyzes also 8-OH-dADP and 2-OH-dADP. Probably removes oxidized guanine nucleotides from both the DNA and RNA precursor pools (By similarity).

Belongs to the Nudix hydrolase family.

325 amino acids

MDSQSSILEENLEKILRGEGLEFDSVAEQVDPVTLRKNVCYIVGAVIFNSKEEVLMVQEAKRECYGRWYLPAGRMEECESILEALQREVREEAGIDCQPITLLLVQEQGPRWVRFIFLAEETGGSLKTTAEADDESLQAHWWDRKSPLPLRAHDILSLIDAGLKYRRNPWFPVTQPVDFPCHVVCQRLFLTFISSRADADDRLWLLMSNNNTSHHPRLPIVVSFRTYISKAVSKLIEDCMPSSYISVHIRGILGVQHNGRIPGKTDGICFNTLVLLENTEEGAEIGSPPSLETDCYRWQEVTNQGLKAKIIERIKDGSVLPFQSL

36.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nudt18 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here