Involved in the biosynthesis of tetrahydrobiopterin, an essential cofactor of aromatic amino acid hydroxylases. Catalyzes the transformation of 7,8-dihydroneopterin triphosphate into 6-pyruvoyl tetrahydropterin (By similarity).

Belongs to the PTPS family.

135 amino acids

MSRTVILTRREVFSSSHRLYSDKLSLEENKKIYGKCINSHGHNYVLEVSIKGAVKEDIGMFMNITELKEILKEKVMDKLDHKNLENDVPELKGIVTTTENLSIFIWDQLFPSLKDFLYEVKILETENNFVVYRGE

15.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ptsA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here