Produces dihydroxyacetone phosphate (DHAP or glycerone phosphate) and malonic semialdehyde (MSA or 3-oxopropanoate) from 6-phospho-5-dehydro-2-deoxy-D-gluconate (DKGP).

Belongs to the class II fructose-bisphosphate aldolase family. IolJ subfamily.

290 amino acids

MAFVTMKHLLAEAKREHYAVGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGFKTISAMVGALMEEMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGSHHPIDENIAMTKEVADYAAKHGVSVEAEVGTVGGMEDGLVGGVRYADVAECERIVKETNIDALAAALGSVHGKYQGEPNLGFKEMEAISRMTDIPLVLHGASGIPQEQIKKAITLGHAKININTECMVAWTDETRRMFQKNGDLYEPRGYMTPGIEAVEETVRSKMREFGSAGKAVKQQVG

31.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make iolJ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here