Description
Methyltransferase involved in the phytoalexin pisatin biosynthesis. Has both 3- and 4'-O-methyltransferase activities. Can use (+)-6a-hydroxymaackiain, 2,7,4'-trihydroxyisoflavanone and with much less activity (+)-medicarpin as substrates, but not (-)-6a-hydroxymaackiain, daidzein, formononetin or isoliquiritigenin. May be involved in formononetin biosynthesis.
Family
Belongs to the class I-like SAM-binding methyltransferase superfamily. Cation-independent O-methyltransferase family. COMT subfamily.
Sequence
MDFSTNGSEESELYHAQIHLYKHVYNFVSSMALKSAMELGIADAIHNHGKPMTLPELSSSLKLHPSKVNILYRFLRLLTHNGFFAKTTVKSNEGEEETAYVLTPSSKLLVSGKSTCLSSLVKGALHPSSLDMWGVSKKWFHEDKEQTLFECATGENYWDFLNKDSDSLSMFQDAMAADSRLFKLAIQENKHVFEGLESLVDVAGGTGGVAKLIHEAFPHIKCTVFDQPQVVGNLTGNENLNFVGGDMFKSVPSADAVLLKWVLHDWNDELSLKILKNSKEAISHKGKDGKVIIIDISIDENSDDRGLTELQLEYDVVMLTMFLGKERTKKEWEKLIYDAGFSRYKITPICGFKSLIEVYP
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service