Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2-butanone 4-phosphate. This is the penultimate step in the biosynthesis of riboflavin.

Belongs to the DMRL synthase family.

155 amino acids

MQVQNIEGSLNASGLKFALVVSRFNDFIGQKLVEGAIDCIVRHGGSADEITVIRCPGAFELPSVTRKAMLSGKYDAIVTLGVIIRGSTPHFDVIAAEATKGIAQVGMEAAIPVSFGVLTTENLEQAIERAGTKAGNKGFDAALAAIEMANLYKQL

16.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ribH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here