Probably plays an important role in the persistence and survival of the virus. May be a structural component in the envelope of the polyhedron or the envelope of the polyhedra-derived virus (PDV) (By similarity).

474 amino acids

MMERQYQSVRSYLINNQHNAIAAGPFLQRVAGPEAHSVGRNVGDRAVRLNRQAVLDLLKLAEDIYADTAYMQADQPEASSRHFATLNRMRLLLIGVQDPDARRNLNSVLARIEALLRVDVVNDAEVNVLSGDFYEEYSKYISYQQTFAQTPTASASQQTQTSLPRPQTSLPRQTQASLPQQTPFDQPEMVSPPSFVHTTPAILPQTTQPPATDTFSRPSDEFVYVPGKERAVPDTRFKPPVPPKPEHLKSRPSSVATNAAGATPVAPPPPPFPSADVTTSMPPPPPPFPSADVTTSMPPPPPMVDLATSMPPPPPPPPPMVDLATSMPPPINNAINNLLIDAMVAETNKNAGDNRSALLDQIKQGKTLKKTQPADGAPATDPRSTLLSEIRQGKTLKKLRKIEDQSSTQTLLKDVDTTDKTKTILKNFVTNIDRISKQEQEEKDRLDTITKRRPAVEHTDGNSTGNNSDDWRDD

52 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ORF2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here