Description
Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.
Family
Belongs to the universal ribosomal protein uL5 family.
Species
Chlamydomonas reinhardtii
Sequence
MREIRISKLVLNIAVAESGDRLQKAAKVLEQLTSQVPVYGRARFTVRSFAIRRNEKISCYVTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFYVCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEFDGVVLNKAPAS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service