Catalyzes the conversion of aminoimidazole ribotide (AIR) to 5-hydroxybenzimidazole (5-HBI) in a radical S-adenosyl-L-methionine (SAM)-dependent reaction. Is thus involved in the anaerobic biosynthesis of the benzimidazole lower axial ligand of the cobamide produced by D.autotrophicum.

Belongs to the ThiC family. 5-hydroxybenzimidazole synthase subfamily.

439 amino acids

MKTQIELARDGIISRQMEQVAADENFNPEIIRTRVAAGEIVIPCNPNRTNQKVVGIGTGLRTKINASIGTSSDICSIENEVQKAIAIEEEGADTLMELSAGGNLDKVRQEVLKAVNLPVGNVPLYQAFKETGRKYNDPSKLDPEFLFDLIERQLSDGLSFMAIHCGINQYTIERLRKQGFRYGGLASKGGTFMVAWMDATGKENPLYEQFDRVCTLMKKYDAVLSLGNGIRAGAIHDSHDRAQMAEMIINCELAELGREQGCQMMVEGPGHVPLDEIQANIILEKRMSGNAPYYVLGPIPADTGAGYDHITSAIGAASSTWHGADLICYITPAEHLALPTEADVREGVRATKLAVRIGDIAKYPDRRENERLASMARRDMRWDDLEQHLLFPDIARKTRASRAPEDGGTCTMCGDFCAMKKGNEIFKDDIKNDKIAPGA

48.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bzaF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here